Soul Lotus

Green-Eyed Serpent Sterling Silver Ring

A sculptural serpent ring inspired by watchfulness, transformation, and quiet strength.

· Sculpted serpent form with detailed scales and green CZ eyes
· 925 sterling silver · approx. 1.58 g
· Adjustable open design · fit 7-9.5 (US)

$63.00
$79.90

Slim in profile, striking in detail.
The serpent coils closely around the finger, with engraved scales adding texture without making the ring feel heavy or oversized. Green CZ eyes create a small flash of color at the head, while the open construction allows gentle fit adjustment.

Green-Eyed Serpent Sterling Silver Ring
Green-Eyed Serpent Sterling Silver Ring
Green-Eyed Serpent Sterling Silver Ring
Green-Eyed Serpent Sterling Silver Ring hand wearing.png__PID:4621d8a2-2f08-4355-b95e-17a89a4588f5
Green-Eyed Serpent Sterling Silver Ring
Green-Eyed Serpent Sterling Silver Ring
Green-Eyed Serpent Sterling Silver Ring
Green-Eyed Serpent Sterling Silver Ring
Green-Eyed Serpent Sterling Silver Ring
soul lotus package.png__PID:55384705-1f11-4f85-ae2d-c5fc277e2ec8
Green-Eyed Serpent Sterling Silver Ring
Green-Eyed Serpent Sterling Silver Ring
Green-Eyed Serpent Sterling Silver Ring
Green-Eyed Serpent Sterling Silver Ring
Green-Eyed Serpent Sterling Silver Ring hand wearing.png__PID:4621d8a2-2f08-4355-b95e-17a89a4588f5
Green-Eyed Serpent Sterling Silver Ring
Green-Eyed Serpent Sterling Silver Ring
Green-Eyed Serpent Sterling Silver Ring
Green-Eyed Serpent Sterling Silver Ring
Green-Eyed Serpent Sterling Silver Ring
soul lotus package.png__PID:55384705-1f11-4f85-ae2d-c5fc277e2ec8
Green-Eyed Serpent Sterling Silver Ring

Designed in the Details

A closer look at what gives the serpent its presence.

925silvergreendiamondsmallsnakefemaleringsideview.jpg__PID:e0959f7a-2197-44c2-aaea-4759b03edd86

A Flash of Green

Two green CZ stones give the serpent its focal point—a small contrast against the cool tone of sterling silver.

925_silver_green_diamond_small_snake_female_ring_front_view.jpg__PID:1e5ce095-9f7a-4197-b4c2-6aea4759b03e

Texture You Notice Up Close

Fine scale engraving runs along the serpent’s body, giving the silver surface depth while keeping the overall silhouette slender and wearable.

Green-Eyed Serpent Sterling Silver Ring hand wearing.png__PID:4621d8a2-2f08-4355-b95e-17a89a4588f5

Designed Around the Finger

Rather than sitting only at the front, the serpent follows the curve of the finger, turning the ring into a continuous sculptural form.

The Serpent in Chinese Culture

The snake has held a visible place in Chinese culture for centuries, including as one of the twelve animals of the Chinese zodiac. Historical zodiac figures preserved from the Song, Jin, Yuan, and Qing periods show how the serpent continued to appear across different forms of Chinese art.

In modern Soul Lotus language, we are drawn to the serpent for a quieter reason: its alert presence, fluid movement, and capacity to shed what it has outgrown.

For us, it becomes a reminder to stay observant, adapt, and move forward without losing your center.

925 Silver Green Diamond Spirit Snake Ring front view2.jpg__PID:d5e555af-b4ae-4028-9d56-fdd6852d5bb1
soul lotus package.png__PID:e3d6da29-add7-40b6-9b6f-6087df11d353

SOUL LOTUS
Meaning, Made Wearable.

Soul Lotus reimagines symbols from Chinese culture as jewelry for modern life—from koi and gourds to clouds, ruyi, taiji, and traditional talismanic forms.

We state materials clearly and treat symbolism as what it is: a source of meaning, reflection, and good wishes—not a promise of any specific outcome.

Rooted in Chinese Culture
Symbols drawn from Chinese art, folklore, philosophy, and traditional visual language—reinterpreted with respect for where they come from.

Designed with Intention
Every motif, proportion, texture, and hidden detail is considered to let traditional symbolism feel natural in modern everyday wear.

A Quiet Blessing, Included
Before each piece leaves China, it is prepared with a quiet Taoist blessing—a symbolic gesture of intention and good wishes for the person who will eventually wear it. (What is a quiet blessing? →)

DISCOVER THE SOUL LOTUS WAY →

What Soul Lotus customers say

Customer Reviews

Based on 1 review
100%
(1)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
M
Maria Gonzalez
Beautiful!

I love it!!

Frequently asked questions

In-stock pieces are normally prepared and dispatched within 1–2 business days. Standard delivery typically takes approximately 7–15 business days after dispatch.

Explore the Story Further

Set of twelve zodiac animals, Tang dynasty, 8th century, earthenware with white slip, The Metropolitan Museum of Art, 2000.662.7a–l

Explore the zodiac, Fuxi and Nüwa, Zhenwu’s tortoise-and-snake, the Legend of the White Snake, Five Poisons imagery, and historical art without reducing them to one fixed meaning.

Snake Meaning in Chinese Culture

Zodiac, Myth, and Folklore

Gold bracelet in the form of a snake, Greek, Ptolemaic, ca. 300–250 BCE, gold, The Metropolitan Museum of Art, 1988.22

Explore why shedding made the serpent a natural image of renewal, how meanings change across cultures, and what snake jewelry can represent today.

Snake Ring Meaning

Transformation, Renewal, and Quiet Strength

Green-Eyed Serpent Sterling Silver Ring wearing women 1.png__PID:e2b500c7-1665-4f35-9822-0912dcdaf2e1

A close look at the Green-Eyed Serpent Ring: its coiling snake form, engraved scales, green eye accents, 925 sterling silver construction, viewing angles, and the details worth checking before you buy.

Inside the Green-Eyed Serpent Ring

Scales, Green Eyes & Coiled Form

Complete The Look

Inspired by the fusion of chinese culture and modern art

Add one more piece to unlock free US shipping $99+

Chalcedony Gourd Chinese Coin Gold-Plated Silver Ring
Not loud, but deep; not bright, but pure.
Chalcedony Gourd Chinese Coin Gold-Plated Silver Ring
Chalcedony Gourd Chinese Coin Gold-Plated Silver Ring
Chalcedony Gourd Chinese Coin Gold-Plated Silver Ring
Chalcedony Gourd Chinese Coin Gold-Plated Silver Ring
Chalcedony Gourd Chinese Coin Gold-Plated Silver Ring
Chalcedony Gourd Chinese Coin Gold-Plated Silver Ring
Not loud, but deep; not bright, but pure.
Chalcedony Gourd Chinese Coin Gold-Plated Silver Ring
Chalcedony Gourd Chinese Coin Gold-Plated Silver Ring
Chalcedony Gourd Chinese Coin Gold-Plated Silver Ring
Chalcedony Gourd Chinese Coin Gold-Plated Silver Ring
Chalcedony Gourd Chinese Coin Gold-Plated Silver Ring

Chalcedony Gourd Chinese Coin Gold-Plated Silver Ring

$126.00
$158.00
Chalcedony Gourd Enamel Ring — Gold-Plated Sterling Silver
May joy be the guest that lingers, and fortune the light that never fades.
Chalcedony Gourd Enamel Ring — Gold-Plated Sterling Silver
Chalcedony Gourd Enamel Ring — Gold-Plated Sterling Silver
Chalcedony Gourd Enamel Ring — Gold-Plated Sterling Silver
Chalcedony Gourd Enamel Ring — Gold-Plated Sterling Silver
Chalcedony Gourd Enamel Ring — Gold-Plated Sterling Silver
Chalcedony Gourd Enamel Ring — Gold-Plated Sterling Silver
Chalcedony Gourd Enamel Ring — Gold-Plated Sterling Silver
Chalcedony Gourd Enamel Ring — Gold-Plated Sterling Silver
May joy be the guest that lingers, and fortune the light that never fades.
Chalcedony Gourd Enamel Ring — Gold-Plated Sterling Silver
Chalcedony Gourd Enamel Ring — Gold-Plated Sterling Silver
Chalcedony Gourd Enamel Ring — Gold-Plated Sterling Silver
Chalcedony Gourd Enamel Ring — Gold-Plated Sterling Silver
Chalcedony Gourd Enamel Ring — Gold-Plated Sterling Silver
Chalcedony Gourd Enamel Ring — Gold-Plated Sterling Silver
Chalcedony Gourd Enamel Ring — Gold-Plated Sterling Silver

Chalcedony Gourd Enamel Ring — Gold-Plated Sterling Silver

$116.00
$145.00
Falling Star Sterling Silver Adjustable Ring
per aspera ad astra
Falling Star Sterling Silver Adjustable Ring
Falling Star Sterling Silver Adjustable Ring
Falling Star Sterling Silver Adjustable Ring
Falling Star Sterling Silver Adjustable Ring
Falling Star Sterling Silver Adjustable Ring
Falling Star Sterling Silver Adjustable Ring
per aspera ad astra
Falling Star Sterling Silver Adjustable Ring
Falling Star Sterling Silver Adjustable Ring
Falling Star Sterling Silver Adjustable Ring
Falling Star Sterling Silver Adjustable Ring
Falling Star Sterling Silver Adjustable Ring

Falling Star Sterling Silver Adjustable Ring

$55.00
$69.90
Golden Wheat Sheaf Teardrop Ring
We meet where the winds of passion blaze fiercely
Golden Wheat Sheaf Teardrop Ring
Golden Wheat Sheaf Teardrop Ring
Golden Wheat Sheaf Teardrop Ring
Golden Wheat Sheaf Teardrop Ring
Golden Wheat Sheaf Teardrop Ring
Golden Wheat Sheaf Teardrop Ring
We meet where the winds of passion blaze fiercely
Golden Wheat Sheaf Teardrop Ring
Golden Wheat Sheaf Teardrop Ring
Golden Wheat Sheaf Teardrop Ring
Golden Wheat Sheaf Teardrop Ring
Golden Wheat Sheaf Teardrop Ring

Golden Wheat Sheaf Teardrop Ring

$39.00
$49.90
Moon Sterling Silver Adjustable Ring
Moon Sterling Silver Adjustable Ring
Moon Sterling Silver Adjustable Ring
Moon Sterling Silver Adjustable Ring
Moon Sterling Silver Adjustable Ring
Moon Sterling Silver Adjustable Ring
Moon Sterling Silver Adjustable Ring
Moon Sterling Silver Adjustable Ring
Moon Sterling Silver Adjustable Ring
Moon Sterling Silver Adjustable Ring
Moon Sterling Silver Adjustable Ring
Moon Sterling Silver Adjustable Ring

Moon Sterling Silver Adjustable Ring

$63.00
$79.90
Ring Of Dying Of The Light
Ring Of Dying Of The Light
Ring Of Dying Of The Light
Ring Of Dying Of The Light
Ring Of Dying Of The Light
Ring Of Dying Of The Light
Ring Of Dying Of The Light
Ring Of Dying Of The Light
Ring Of Dying Of The Light
Ring Of Dying Of The Light

Ring Of Dying Of The Light

$63.00
$79.90

Sign up for a free Soul Lotus membership and receive monthly special fortune guidance!

Simply provide your email to quickly and easily register as a Soul Lotus member for free. As a basic member, you'll receive our Soul Lotus newsletter and be the first to know about new product releases. Additionally, at the beginning of each month, you’ll receive a detailed monthly fortune guide, carefully crafted by our metaphysical and feng shui experts, based on your birth month and applicable to everyone! 

After registering, your purchases will start accumulating membership points, which we call 'Lotus Points.' As your points grow, you’ll be able to level up to higher membership tiers. Once you’ve accumulated enough points, you can redeem them for free shipping or exclusive discount cards!